PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.B7BPA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 199aa    MW: 22716.9 Da    PI: 4.4621
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.B7BPAgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.35.3e-0824394156
                 HHHHHHHHHHHHHHHH CS
     Homeobox 41 erqVkvWFqNrRakek 56
                  rqV +WFqNrRa++k
  Aradu.B7BPA 24 PRQVAIWFQNRRARWK 39
                 59*************9 PP

2HD-ZIP_I/II73.54e-2421773793
  HD-ZIP_I/II 37 glqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
                 +  prqva+WFqnrRAR+ktkqlEkdy++L++++d+lk++ ++L ke+++L++e+++
  Aradu.B7BPA 21 DEAPRQVAIWFQNRRARWKTKQLEKDYDSLQATFDTLKANYDNLLKEKDRLKAEVAR 77
                 557*************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.7181741IPR001356Homeobox domain
SuperFamilySSF466891.49E-72350IPR009057Homeodomain-like
CDDcd000869.24E-62442No hitNo description
Gene3DG3DSA:1.10.10.609.8E-92449IPR009057Homeodomain-like
PfamPF000462.3E-52539IPR001356Homeobox domain
PfamPF021832.4E-174182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MVSFEDVPGG KGEQAGAREE DEAPRQVAIW FQNRRARWKT KQLEKDYDSL QATFDTLKAN  60
YDNLLKEKDR LKAEVARLTE KVVAREKEGE DKSERKGMQE ATAAAVSSEG EGSKISVKSD  120
MLDSDDNINS PYYHTTSGMF EADQSDLSQD EEENLINRSL LHPYLIFPKL EHVEYSDPPE  180
TSCNFGFAHE DHAIWSWSY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13341RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016192695.11e-127PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022831e-24HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLI1KCP43e-66I1KCP4_SOYBN; Uncharacterized protein
TrEMBLQ2VTE62e-66Q2VTE6_SOYBN; HDZip I protein
STRINGGLYMA06G20230.18e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15003499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.17e-26homeobox 1